PDB entry 1bf6

View 1bf6 on RCSB PDB site
Description: phosphotriesterase homology protein from escherichia coli
Deposited on 1998-05-27, released 1999-06-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.204
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bf6a_
  • Chain 'B':
    Domains in SCOP 1.55: d1bf6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf6A (A:)
    sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr
    naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag
    iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr
    vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls
    mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf6B (B:)
    sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr
    naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag
    iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr
    vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls
    mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq