PDB entry 1bf5

View 1bf5 on RCSB PDB site
Description: tyrosine phosphorylated stat-1/DNA complex
Class: gene regulation/DNA
Keywords: complex (sh2 domain-DNA), sh2 domain, transcription factor, gene regulation-DNA complex
Deposited on 1998-05-27, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal transducer and activator of transcription 1-alpha/beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42224 (0-574)
      • modified tyr (565)
    Domains in SCOPe 2.07: d1bf5a1, d1bf5a2, d1bf5a3
  • Chain 'B':
    Compound: DNA (5'-d(*ap*cp*ap*gp*tp*tp*tp*cp*cp*cp*gp*tp*ap*ap*ap*tp*g p*c)-3')
    Species: Homo sapiens [TaxId:9606]
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*cp*ap*tp*tp*tp*ap*cp*gp*gp*gp*ap*ap*ap*cp*t p*g)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bf5A (A:)
    ldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnrehetngvaksdqkqe
    qlllkkmylmldnkrkevvhkiiellnvteltqnalindelvewkrrqqsaciggppnac
    ldqlqnwftivaeslqqvrqqlkkleeleqkytyehdpitknkqvlwdrtfslfqqliqs
    sfvverqpcmpthpqrplvlktgvqftvklrllvklqelnynlkvkvlfdkdvnerntvk
    gfrkfnilgthtkvmnmeestngslaaefrhlqlkeqknagtrtnegplivteelhslsf
    etqlcqpglvidlettslpvvvisnvsqlpsgwasilwynmlvaeprnlsffltppcarw
    aqlsevlswqfssvtkrglnvdqlnmlgekllgpnaspdglipwtrfckenindknfpfw
    lwiesilelikkhllplwndgcimgfiskererallkdqqpgtfllrfsessregaitft
    wversqnggepdfhavepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdh
    afgkyysrpkeapepmeldgpkgtgyiktelisvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bf5A (A:)
    ldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnrehlllkkmylmldnk
    rkevvhkiiellnvteltqnalindelvewkrrqqsaciggppnacldqlqnwftivaes
    lqqvrqqlkkleeleqkytyehdpitknkqvlwdrtfslfqqliqssfvverqpcmpthp
    qrplvlktgvqftvklrllvklqelnynlkvkvlfdkdvnerntvkgfrkfnilgthtkv
    mnmeestngslaaefrhlqlkeqknagtrtnegplivteelhslsfetqlcqpglvidle
    ttslpvvvisnvsqlpsgwasilwynmlvaeprnlsffltppcarwaqlsevlswqfssv
    tkrglnvdqlnmlgekllgpnaspdglipwtrfckenindknfpfwlwiesilelikkhl
    lplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqnggepdfh
    avepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysrgyikte
    lisvs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.