PDB entry 1bf4

View 1bf4 on RCSB PDB site
Description: chromosomal dna-binding protein sso7d/d(gcgaacgc) complex
Deposited on 1998-05-27, released 1999-06-08
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bf4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf4A (A:)
    atvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qkk