PDB entry 1bf3

View 1bf3 on RCSB PDB site
Description: p-hydroxybenzoate hydroxylase (phbh) mutant with cys 116 replaced by ser (c116s) and arg 42 replaced by lys (r42k), in complex with fad and 4-hydroxybenzoic acid
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1998-05-26, released 1998-08-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-hydroxybenzoate hydroxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: POBA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00438 (0-End)
      • engineered (41)
      • engineered (115)
    Domains in SCOPe 2.05: d1bf3a1, d1bf3a2
  • Heterogens: FAD, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bf3A (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgkiragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
    telkarlpaevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyeeie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bf3A (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgkiragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
    telkarlpaevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpye