PDB entry 1bf2

View 1bf2 on RCSB PDB site
Description: structure of pseudomonas isoamylase
Class: hydrolase
Keywords: hydrolase, glycosidase, debranching enzyme
Deposited on 1998-05-26, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoamylase
    Species: Pseudomonas amyloderamosa [TaxId:32043]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bf2a1, d1bf2a2, d1bf2a3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf2A (A:)
    ainsmslgasydaqqanitfrvyssqatrivlylysagygvqesatytlspagsgvwavt
    vpvssikaagitgavyygyrawgpnwpyasnwgkgsqagfvsdvdangdrfnpnkllldp
    yaqevsqdplnpsnqngnvfasgasyrttdsgiyapkgvvlvpstqstgtkptraqkddv
    iyevhvrgfteqdtsipaqyrgtyygaglkasylaslgvtaveflpvqetqndandvvpn
    sdanqnywgymtenyfspdrryaynkaaggptaefqamvqafhnagikvymdvvynhtae
    ggtwtssdpttatiyswrgldnatyyeltsgnqyfydntgiganfntyntvaqnlivdsl
    aywantmgvdgfrfdlasvlgnsclngaytasapncpnggynfdaadsnvainrilreft
    vrpaaggsgldlfaepwaiggnsyqlggfpqgwsewnglfrdslrqaqnelgsmtiyvtq
    dandfsgssnlfqssgrspwnsinfidvhdgmtlkdvyscngannsqawpygpsdggtst
    nyswdqgmsagtgaavdqrraartgmafemlsagtplmqggdeylrtlqcnnnaynldss
    anwltyswttdqsnfytfaqrliafrkahpalrpsswysgsqltwyqpsgavadsnywnn
    tsnyaiayaingpslgdsnsiyvayngwsssvtftlpappsgtqwyrvtdtcdwndgast
    fvapgsetliggagttygqcgqsllllisk