PDB entry 1bf0

View 1bf0 on RCSB PDB site
Description: calcicludine (cac) from green mamba dendroaspis angusticeps, nmr, 15 structures
Class: calcium channel blocker
Keywords: calcium channel blocker
Deposited on 1998-05-26, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcicludine
    Species: Dendroaspis angusticeps [TaxId:8618]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bf0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf0A (A:)
    wqppwyckepvrigsckkqfssfyfkwtakkclpflfsgcggnanrfqtigecrkkclgk