PDB entry 1bet

View 1bet on RCSB PDB site
Description: new protein fold revealed by a 2.3 angstrom resolution crystal structure of nerve growth factor
Class: growth factor
Keywords: growth factor
Deposited on 1993-04-08, released 1994-05-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1beta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1betA (A:)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrka