PDB entry 1bet

View 1bet on RCSB PDB site
Description: new protein fold revealed by a 2.3 angstrom resolution crystal structure of nerve growth factor
Deposited on 1993-04-08, released 1994-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bet__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bet_ (-)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrka