PDB entry 1bet

View 1bet on RCSB PDB site
Description: new protein fold revealed by a 2.3 angstrom resolution crystal structure of nerve growth factor
Class: growth factor
Keywords: growth factor
Deposited on 1993-04-08, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-nerve growth factor
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01139 (0-106)
  Domains in SCOPe 2.08: d1beta_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1betA (A:)
  gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
  gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrka