PDB entry 1ber

View 1ber on RCSB PDB site
Description: structure of the cap-dna complex at 2.5 angstroms resolution: a complete picture of the protein-dna interface
Deposited on 1996-01-26, released 1996-07-11
The last revision was dated 2002-03-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*gp*ap*ap*ap*ap*gp*tp*gp*tp*gp*ap*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*tp*ap*tp*gp*tp*cp*ap*cp*ap*cp*tp*tp*tp*tp*cp*g)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*gp*ap*ap*ap*ap*gp*tp*gp*tp*gp*ap*c)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*ap*tp*ap*tp*gp*tp*cp*ap*cp*ap*cp*tp*tp*tp*tp*cp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1berA (A:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records):
    >1berA (A:)
    ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
    figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
    ekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilk
    mledqnlisahgktivvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1berB (B:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records):
    >1berB (B:)
    ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
    figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
    ekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilk
    mledqnlisahgktivv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.