PDB entry 1beo

View 1beo on RCSB PDB site
Description: beta-cryptogein
Class: fungal toxic elicitor
Keywords: fungal toxic elicitor, elicitin, toxin, plant pathogen
Deposited on 1996-08-02, released 1997-05-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-cryptogein
  Species: Phytophthora cryptogea
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15570 (0-97)
  Domains in SCOP 1.75: d1beoa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1beoA (A:)
  tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
  kkivtlnppncdltvptsglvlnvysyangfsnkcssl