PDB entry 1beo

View 1beo on RCSB PDB site
Description: beta-cryptogein
Deposited on 1996-08-02, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1beo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1beo_ (-)
    tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
    kkivtlnppncdltvptsglvlnvysyangfsnkcssl