PDB entry 1beo

View 1beo on RCSB PDB site
Description: beta-cryptogein
Class: fungal toxic elicitor
Keywords: fungal toxic elicitor, elicitin, toxin, plant pathogen
Deposited on 1996-08-02, released 1997-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-cryptogein
    Species: Phytophthora cryptogea [TaxId:4786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1beoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1beoA (A:)
    tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
    kkivtlnppncdltvptsglvlnvysyangfsnkcssl