PDB entry 1ben

View 1ben on RCSB PDB site
Description: insulin complexed with 4-hydroxybenzamide
Class: hormone
Keywords: insulin, hormone, glucose metabolism
Deposited on 1996-02-15, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.154
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ben.1
  • Chain 'B':
    Compound: human insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ben.1
  • Chain 'C':
    Compound: human insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ben.2
  • Chain 'D':
    Compound: human insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ben.2
  • Heterogens: ZN, CL, HBD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1benA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1benB (B:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1benC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1benD (D:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1benD (D:)
    fvnqhlcgshlvealylvcgergffytp