PDB entry 1ben

View 1ben on RCSB PDB site
Description: insulin complexed with 4-hydroxybenzamide
Class: hormone
Keywords: insulin, hormone, glucose metabolism
Deposited on 1996-02-15, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.154
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1ben.1
• Chain 'B':
  Compound: human insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1ben.1
• Chain 'C':
  Compound: human insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1ben.2
• Chain 'D':
  Compound: human insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1ben.2
• Heterogens: ZN, CL, HBD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1benA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1benB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1benC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >1benD (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1benD (D:)
  fvnqhlcgshlvealylvcgergffytp