PDB entry 1bei

View 1bei on RCSB PDB site
Description: Shk-dnp22: A Potent Kv1.3-specific immunosuppressive polypeptide, NMR, 20 structures
Class: potassium channel inhibitor
Keywords: potassium channel inhibitor, sea anemone, immunosuppressant neurotoxin
Deposited on 1998-05-14, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: potassium channel toxin shk
  Species: Stichodactyla helianthus [TaxId:6123]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29187 (0-34)
    • substitution (21)
  Domains in SCOPe 2.07: d1beia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1beiA (A:)
  rscidtipksrctafqckhsmayrlsfcrktcgtc