PDB entry 1beg

View 1beg on RCSB PDB site
Description: structure of fungal elicitor, nmr, 18 structures
Class: signal
Keywords: signal, fungal elicitor, signalling protein, fungal toxin
Deposited on 1996-11-26, released 1997-12-03
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-elicitin cryptogein
    Species: Phytophthora cryptogea
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bega_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1begA (A:)
    tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
    kkivtlnppncdltvptsglvlnvysyangfsnkcssl