PDB entry 1beg

View 1beg on RCSB PDB site
Description: structure of fungal elicitor, nmr, 18 structures
Deposited on 1996-11-26, released 1997-12-03
The last revision prior to the SCOP 1.57 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1beg__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1beg_ (-)
  tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
  kkivtlnppncdltvptsglvlnvysyangfsnkcssl