PDB entry 1bef

View 1bef on RCSB PDB site
Description: crystal structure of dengue virus ns3 serine protease
Class: protease
Keywords: protease, trypsin-like, viral-maturation
Deposited on 1998-05-14, released 1999-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dengue virus ns3 serine protease
    Species: Dengue virus [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Q4T1 (Start-180)
      • conflict (148)
    Domains in SCOPe 2.07: d1befa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1befA (A:)
    agvlwdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmh
    kgkriepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktna
    gtigavsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeied
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1befA (A:)
    wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
    iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
    avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd