PDB entry 1beb

View 1beb on RCSB PDB site
Description: bovine beta-lactoglobulin, lattice x
Class: lipocalin
Keywords: lipocalin, milk whey protein, bovine, retinol-binding
Deposited on 1996-12-20, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754
      • variant (117)
    Domains in SCOPe 2.07: d1beba_
  • Chain 'B':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754
      • variant (117)
    Domains in SCOPe 2.07: d1bebb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bebA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bebA (A:)
    qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkweng
    ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
    tpevddealekfdkalkalpmhirlsfnptqleeqc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bebB (B:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bebB (B:)
    qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkweng
    ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
    tpevddealekfdkalkalpmhirlsfnptqleeqc