PDB entry 1be4

View 1be4 on RCSB PDB site
Description: nucleoside diphosphate kinase isoform b from bovine retina
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1998-05-19, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1be4a_
  • Chain 'B':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1be4b_
  • Chain 'C':
    Compound: nucleoside diphosphate transferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1be4c_
  • Heterogens: PCG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be4A (A:)
    ansertfiaikpdgvqrglmgeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfrpeelvnykscaqnwiye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be4B (B:)
    ansertfiaikpdgvqrglmgeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfrpeelvnykscaqnwiye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be4C (C:)
    ansertfiaikpdgvqrglmgeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeialwfrpeelvnykscaqnwiye