PDB entry 1be2

View 1be2 on RCSB PDB site
Description: lipid transfer protein complexed with palmitate, nmr, 10 structures
Class: lipid transport
Keywords: lipid transport, lipid transfer protein, palmitate, binding
Deposited on 1998-05-19, released 1998-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipid transfer protein
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1be2a_
  • Heterogens: PLM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1be2A (A:)
lncgqvdskmkpcltyvqggpgpsgeccngvrdlhnqaqssgdrqtvcnclkgiargihn
lnlnnaasipskcnvnvpytispdidcsriy