PDB entry 1be1

View 1be1 on RCSB PDB site
Description: glutamate mutase (b12-binding subunit), nmr, minimized average structure
Class: isomerase
Keywords: isomerase, glutamate mutase, b12-binding subunit
Deposited on 1998-05-19, released 1998-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glutamate mutase
  Species: Clostridium tetanomorphum [TaxId:1553]
  Gene: MUTS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05488 (0-136)
  Domains in SCOPe 2.06: d1be1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1be1A (A:)
  mekktivlgvigsdchavgnkildhsftnagfnvvnigvlssqedfinaaietkadlicv
  sslygqgeidckglrekcdeaglkgiklfvggnivvgkqnwpdveqrfkamgfdrvyppg
  tspettiadmkevlgve