PDB entry 1be1

View 1be1 on RCSB PDB site
Description: glutamate mutase (b12-binding subunit), nmr, minimized average structure
Class: isomerase
Keywords: isomerase, glutamate mutase, b12-binding subunit
Deposited on 1998-05-19, released 1998-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate mutase
    Species: Clostridium tetanomorphum [TaxId:1553]
    Gene: MUTS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1be1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be1A (A:)
    mekktivlgvigsdchavgnkildhsftnagfnvvnigvlssqedfinaaietkadlicv
    sslygqgeidckglrekcdeaglkgiklfvggnivvgkqnwpdveqrfkamgfdrvyppg
    tspettiadmkevlgve