PDB entry 1be0

View 1be0 on RCSB PDB site
Description: haloalkane dehalogenase at ph 5.0 containing acetic acid
Class: dehalogenase
Keywords: dehalogenase, alpha/beta-hydrolase
Deposited on 1998-05-18, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Xanthobacter autotrophicus [TaxId:280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22643 (0-309)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d1be0a_
  • Heterogens: ACT, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be0A (A:)
    mvnairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
    ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
    vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlv
    tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
    isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
    ealkhfaete