PDB entry 1bdy

View 1bdy on RCSB PDB site
Description: c2 domain from protein kinase c delta
Deposited on 1998-05-11, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1976
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bdya_
  • Chain 'B':
    Domains in SCOP 1.55: d1bdyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdyA (A:)
    mapflrisfnsyelgslqaeddasqpfcavkmkealttdrgktlvqkkptmypewkstfd
    ahiyegrviqivlmraaedpmsevtvgvsvlaerckknngkaefwldlqpqakvlmcvqy
    fle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdyB (B:)
    mapflrisfnsyelgslqaeddasqpfcavkmkealttdrgktlvqkkptmypewkstfd
    ahiyegrviqivlmraaedpmsevtvgvsvlaerckknngkaefwldlqpqakvlmcvqy
    fle