PDB entry 1bdx

View 1bdx on RCSB PDB site
Description: e. coli DNA helicase ruva with bound DNA holliday junction, alpha carbons and phosphate atoms only
Class: transferase/DNA
Keywords: DNA-binding, branch migration, holliday junction, ruv, complex DNA-binding protein-DNA, transferase-DNA complex
Deposited on 1998-05-11, released 1999-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holliday junction DNA helicase ruva
    Species: Escherichia coli [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bdxa1, d1bdxa2, d1bdxa3
  • Chain 'B':
    Compound: holliday junction DNA helicase ruva
    Species: Escherichia coli [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bdxb1, d1bdxb2, d1bdxb3
  • Chain 'C':
    Compound: holliday junction DNA helicase ruva
    Species: Escherichia coli [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bdxc1, d1bdxc2, d1bdxc3
  • Chain 'D':
    Compound: holliday junction DNA helicase ruva
    Species: Escherichia coli [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bdxd1, d1bdxd2, d1bdxd3
  • Chain 'J':
    Compound: DNA (5'-d(p*gp*cp*ap*tp*gp*cp*ap*tp*ap*tp*gp*cp*ap*tp*gp*c)-3')
  • Chain 'K':
    Compound: DNA (5'-d(p*gp*cp*ap*tp*gp*cp*ap*tp*ap*tp*gp*cp*ap*tp*gp*c)-3')
  • Chain 'L':
    Compound: DNA (5'-d(p*gp*cp*ap*tp*gp*cp*ap*tp*ap*tp*gp*cp*ap*tp*gp*c)-3')
  • Chain 'M':
    Compound: DNA (5'-d(p*gp*cp*ap*tp*gp*cp*ap*tp*ap*tp*gp*cp*ap*tp*gp*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdxA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltspaspatddaeqeavaalvalgykpqeasrm
    vskiarpdassetlirealraal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdxA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftptddaeqeavaalvalgykpqeasrmvskiarpdasset
    lirealraal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bdxB (B:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltspaspatddaeqeavaalvalgykpqeasrm
    vskiarpdassetlirealraal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdxB (B:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftptddaeqeavaalvalgykpqeasrmvskiarpdasset
    lirealraal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bdxC (C:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltspaspatddaeqeavaalvalgykpqeasrm
    vskiarpdassetlirealraal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdxC (C:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftptddaeqeavaalvalgykpqeasrmvskiarpdasset
    lirealraal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bdxD (D:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltspaspatddaeqeavaalvalgykpqeasrm
    vskiarpdassetlirealraal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdxD (D:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftptddaeqeavaalvalgykpqeasrmvskiarpdasset
    lirealraal
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.