PDB entry 1bdv

View 1bdv on RCSB PDB site
Description: arc fv10 cocrystal
Class: gene regulation/DNA
Keywords: gene-regulating protein, gene regulation-DNA complex
Deposited on 1998-05-11, released 1999-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (arc fv10 repressor)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03050
      • engineered (9)
    Domains in SCOPe 2.07: d1bdva_
  • Chain 'B':
    Compound: protein (arc fv10 repressor)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03050 (0-52)
      • engineered (9)
    Domains in SCOPe 2.07: d1bdvb_
  • Chain 'C':
    Compound: protein (arc fv10 repressor)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03050
      • engineered (9)
    Domains in SCOPe 2.07: d1bdvc_
  • Chain 'D':
    Compound: protein (arc fv10 repressor)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03050 (0-End)
      • engineered (9)
    Domains in SCOPe 2.07: d1bdvd_
  • Chain 'E':
    Compound: DNA (5'-d(*tp*ap*tp*ap*gp*tp*ap*gp*ap*gp*tp*gp*cp*tp*tp*cp*tp*ap*tp*cp*ap*t)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*ap*ap*tp*gp*ap*tp*ap*gp*ap*ap*gp*cp*ap*cp*tp*cp*tp*ap*cp*tp*ap*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdvA (A:)
    mkgmskmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdvA (A:)
    mpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegrig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdvB (B:)
    mkgmskmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bdvC (C:)
    mkgmskmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdvC (C:)
    mpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bdvD (D:)
    mkgmskmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdvD (D:)
    mkgmskmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.