PDB entry 1bds

View 1bds on RCSB PDB site
Description: determination of the three-dimensional solution structure of the antihypertensive and antiviral protein bds-I from the sea anemone anemonia sulcata. a study using nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing
Class: anti-hypertensive, anti-viral protein
Keywords: anti-hypertensive, anti-viral protein
Deposited on 1988-11-14, released 1989-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bds-I
  Species: Anemonia sulcata [TaxId:6108]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11494 (0-42)
  Domains in SCOPe 2.08: d1bdsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bdsA (A:)
  aapcfcsgkpgrgdlwilrgtcpggygytsncykwpniccyph