PDB entry 1bdr

View 1bdr on RCSB PDB site
Description: hiv-1 (2: 31, 33-37) protease complexed with inhibitor sb203386
Class: hydrolase
Keywords: hydrolase, aids, polyprotein, aspartyl protease, acid protease, hydroxyethylene isostere inhibitor, substrate analogue inhibitor
Deposited on 1998-05-10, released 1998-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.201
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 PROTEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (30)
      • engineered (32)
      • conflict (33)
      • engineered (34-36)
    Domains in SCOPe 2.03: d1bdra_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 PROTEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (30)
      • engineered (32)
      • conflict (33)
      • engineered (34-36)
    Domains in SCOPe 2.03: d1bdrb_
  • Heterogens: IM1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdrA (A:)
    pqitlwqrplvtikiggqlkealldtgaddsvvagielpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdrB (B:)
    pqitlwqrplvtikiggqlkealldtgaddsvvagielpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf