PDB entry 1bdo

View 1bdo on RCSB PDB site
Description: structure of the biotinyl domain of acetyl-coenzyme a carboxylase determined by mad phasing
Class: transferase
Keywords: bccpsc, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase, transferase
Deposited on 1995-11-21, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: BIOTIN CARBOXYL CARRIER PROTEI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bdoa_
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdoA (A:)
    eisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqieadksgtvk
    ailvesgqpvefdeplvvie