PDB entry 1bdm

View 1bdm on RCSB PDB site
Description: the structure at 1.8 angstroms resolution of a single site mutant (t189i) of malate dehydrogenase from thermus flavus with increased enzymatic activity
Deposited on 1993-02-16, released 1994-12-20
The last revision prior to the SCOP 1.55 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdmA (A:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpdvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhssimfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdmA (A:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpdvafkdadyallvgaaprlqvngkifteqgralaevakkdvkvlvv
    gnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirrmtvwgnhss
    imfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaasaanaaiehi
    rdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvvegleinefarkrmei
    taqelldemeqvkalgli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdmB (B:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpdvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhssimfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli