PDB entry 1bdg

View 1bdg on RCSB PDB site
Description: hexokinase from schistosoma mansoni complexed with glucose
Class: hexokinase
Keywords: hexokinase, phosphotransferase
Deposited on 1998-05-08, released 1999-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexokinase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26609
      • sequencing error (32)
    Domains in SCOPe 2.08: d1bdga1, d1bdga2
  • Heterogens: GLC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdgA (A:)
    mvfsdqqlfekvveilkpfdlsvvdyeeicdrmgesmrlglqkstnekssikmfpsyvtk
    tpngtetgnflaldlggtnyrvlsvtlegkgkspriqertycipaekmsgsgtelfkyia
    etladflenngmkdkkfdlgftfsfpcvqkglthatlvrwtkgfsadgveghnvaellqt
    eldkrelnvkcvavvndtvgtlascaledpkcavglivgtgtnvayiedsskvelmdgvk
    epevvintewgafgekgeldcwrtqfdksmdidslhpgkqlyekmvsgmylgelvrhiiv
    ylveqkilfrgdlperlkvrnslltryltdverdpahllynthymltddlhvpvvepidn
    rivryacemvvkraaylagagiacilrrinrsevtvgvdgslykfhpkfcermtdmvdkl
    kpkntrfclrlsedgsgkgaaaiaasctrqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdgA (A:)
    fsdqqlfekvveilkpfdlsvvdyeeicdrmgesmrlglqkstnekssikmfpsyvtktp
    ngtetgnflaldlggtnyrvlsvtleggkspriqertycipaekmsgsgtelfkyiaetl
    adflenngmkdkkfdlgftfsfpcvqkglthatlvrwtkgfsadgveghnvaellqteld
    krelnvkcvavvndtvgtlascaledpkcavglivgtgtnvayiedsskvelmdgvkepe
    vvintewgafgekgeldcwrtqfdksmdidslhpgkqlyekmvsgmylgelvrhiivylv
    eqkilfrgdlperlkvrnslltryltdverdpahllynthymltddlhvpvvepidnriv
    ryacemvvkraaylagagiacilrrinrsevtvgvdgslykfhpkfcermtdmvdklkpk
    ntrfclrlsedgsgkgaaaiaasc