PDB entry 1bdf

View 1bdf on RCSB PDB site
Description: structure of escherichia coli RNA polymerase alpha subunit n-terminal domain
Class: nucleotidyltransferase
Keywords: nucleotidyltransferase, rnap, alpha, assemble
Deposited on 1998-05-08, released 1999-05-11
The last revision prior to the SCOP 1.75 freeze date was dated 1999-05-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase alpha subunit
    Species: ESCHERICHIA COLI
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Z4
      • engineered (44)
    Domains in SCOP 1.75: d1bdfa1, d1bdfa2
  • Chain 'B':
    Compound: RNA polymerase alpha subunit
    Species: ESCHERICHIA COLI
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Z4 (0-234)
      • engineered (44)
    Domains in SCOP 1.75: d1bdfb1, d1bdfb2
  • Chain 'C':
    Compound: RNA polymerase alpha subunit
    Species: ESCHERICHIA COLI
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Z4 (0-234)
      • engineered (44)
    Domains in SCOP 1.75: d1bdfc1, d1bdfc2
  • Chain 'D':
    Compound: RNA polymerase alpha subunit
    Species: ESCHERICHIA COLI
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Z4 (0-234)
      • engineered (44)
    Domains in SCOP 1.75: d1bdfd1, d1bdfd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdfA (A:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrllvdacyspv
    eriaynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdfA (A:)
    qgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavtevei
    dgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgdv
    eivkpqhvichltdenasismrikvqrgrgyvpastrierpigrllvdacyspveriayn
    veaarveqrtdldklviemetngtidpeeairraatilaeqleafv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bdfB (B:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrllvdacyspv
    eriaynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdfB (B:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihderpigrllvdacyspveri
    aynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bdfC (C:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrllvdacyspv
    eriaynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdfC (C:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihigrllvdacyspveriaynv
    eaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bdfD (D:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrllvdacyspv
    eriaynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdfD (D:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastriherpigrllvdacyspveria
    ynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr