PDB entry 1bdf

View 1bdf on RCSB PDB site
Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain
Deposited on 1998-05-08, released 1999-05-11
The last revision prior to the SCOP 1.63 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdfA (A:)
    qgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavtevei
    dgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgdv
    eivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrllvdacyspve
    riaynveaarveqrtdldklviemetngtidpeeairraatilaeqleafv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdfA (A:)
    qgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavtevei
    dgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgdv
    eivkpqhvichltdenasismrikvqrgrgyvpastrierpigrllvdacyspveriayn
    veaarveqrtdldklviemetngtidpeeairraatilaeqleafv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bdfB (B:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrllvdacyspv
    eriaynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdfB (B:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihderpigrllvdacyspveri
    aynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bdfC (C:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrllvdacyspv
    eriaynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdfC (C:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihigrllvdacyspveriaynv
    eaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bdfD (D:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrllvdacyspv
    eriaynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdfD (D:)
    mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpgcavteve
    idgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvtaadithdgd
    veivkpqhvichltdenasismrikvqrgrgyvpastriherpigrllvdacyspveria
    ynveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr