PDB entry 1bde

View 1bde on RCSB PDB site
Description: helical structure of polypeptides from the c-terminal half of hiv-1 vpr, nmr, 20 structures
Class: aids
Keywords: aids, hiv, viral protein, vpr fragment, helix
Deposited on 1998-05-07, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vpr protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12520 (0-32)
  Domains in SCOPe 2.07: d1bdea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bdeA (A:)
  ygdtwagveaiirilqqllfihfrigcrhsrig