PDB entry 1bdc

View 1bdc on RCSB PDB site
Description: staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures
Class: immunoglobulin-binding protein
Keywords: immunoglobulin-binding protein, repeat, transmembrane, cell wall, signal, immunoglobulin binding domain
Deposited on 1996-06-28, released 1997-01-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcus aureus protein a
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: synthetic gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1bdca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdcA (A:)
    tadnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapka