PDB entry 1bdc

View 1bdc on RCSB PDB site
Description: staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures
Deposited on 1996-06-28, released 1997-01-11
The last revision prior to the SCOP 1.63 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1bdc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdc_ (-)
    tadnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapka