PDB entry 1bdb

View 1bdb on RCSB PDB site
Description: cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase from pseudomonas sp. lb400
Class: oxidoreductase
Keywords: nad-dependent oxidoreductase, short-chain alcohol dehydrogenase, pcb degradation, oxidoreductase
Deposited on 1997-05-10, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bdba_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdbA (A:)
    mklkgeavlitggasglgralvdrfvaegakvavldksaerlaeletdhgdnvlgivgdv
    rsledqkqaasrcvarfgkidtlipnagiwdystalvdlpeesldaafdevfhinvkgyi
    havkaclpalvasrgnviftisnagfypngggplytaakhaivglvrelafelapyvrvn
    gvgsgginsdlrgpsslgmgskaistvpladmlksvlpigrmpeveeytgayvffatrgd
    aapatgallnydgglgvrgffsgaggndlleqlnihp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdbA (A:)
    mklkgeavlitggasglgralvdrfvaegakvavldksaerlaeletdhgdnvlgivgdv
    rsledqkqaasrcvarfgkidtlipnagiwdystalvdlpeesldaafdevfhinvkgyi
    havkaclpalvasrgnviftisnagfypngggplytaakhaivglvrelafelapyvrvn
    gvgsgginsdlrgpsslgpladmlksvlpigrmpeveeytgayvffatrgdaapatgall
    nydgglgvrgffsgaggndlleqlnih