PDB entry 1bda

View 1bda on RCSB PDB site
Description: catalytic domain of human single chain tissue plasminogen activator in complex with dansyl-egr-cmk (dansyl-glu-gly-arg chloromethyl ketone)
Class: hydrolase/hydrolase inhibitor
Keywords: trypsin like serine protease, fibrinolytic enzymes, plasminogen activators, hydrolase-hydrolase inhibitor complex
Deposited on 1998-05-07, released 1999-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.311
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single chain tissue type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bdaa_
  • Chain 'B':
    Compound: single chain tissue type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bdab_
  • Heterogens: 2Z0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdaA (A:)
    tcglrqysqpqfrikgglfadiashpwqaaifakhrrspgerflcggilisscwilsaah
    cfqerfpphhltvilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdss
    rcaqessvvrtvclppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrct
    sqhllnrtvtdnmlcagdtrsggpqanlhdacqgdsggplvclndgrmtlvgiiswglgc
    gqkdvpgvytkvtnyldwirdnmrp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdaB (B:)
    tcglrqysqpqfrikgglfadiashpwqaaifakhrrspgerflcggilisscwilsaah
    cfqerfpphhltvilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdss
    rcaqessvvrtvclppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrct
    sqhllnrtvtdnmlcagdtrsggpqanlhdacqgdsggplvclndgrmtlvgiiswglgc
    gqkdvpgvytkvtnyldwirdnmrp