PDB entry 1bd9

View 1bd9 on RCSB PDB site
Description: human phosphatidylethanolamine binding protein
Class: lipid binding protein
Keywords: lipid-binding, signalling, lipid binding protein
Deposited on 1998-05-12, released 1998-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.171
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylethanolamine binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bd9a_
  • Chain 'B':
    Compound: phosphatidylethanolamine binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bd9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bd9A (A:)
    mpvdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdglds
    gklytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhry
    vwlvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpkl
    yeqlsgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bd9A (A:)
    lskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdgldsgkly
    tlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhryvwlv
    yeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpklyeql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bd9B (B:)
    mpvdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdglds
    gklytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhry
    vwlvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpkl
    yeqlsgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bd9B (B:)
    pvdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdgldsg
    klytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhryv
    wlvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpkly
    eqlsg