PDB entry 1bd8

View 1bd8 on RCSB PDB site
Description: structure of cdk inhibitor p19ink4d
Class: tumor suppressor
Keywords: tumor suppressor, cdk4/6 inhibitor, ankyrin motif
Deposited on 1998-05-12, released 1998-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p19ink4d cdk4/6 inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1bd8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bd8A (A:)
    ragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqgas
    pnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsfl
    aaesdlhrrdargltplelalqrgaqdlvdilqghm