PDB entry 1bd8

View 1bd8 on RCSB PDB site
Description: structure of cdk inhibitor p19ink4d
Deposited on 1998-05-12, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bd8__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bd8_ (-)
ragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqgas
pnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsfl
aaesdlhrrdargltplelalqrgaqdlvdilqghm