PDB entry 1bcx

View 1bcx on RCSB PDB site
Description: mutational and crystallographic analyses of the active site residues of the bacillus circulans xylanase
Class: hydrolase(xylan degradation)
Keywords: hydrolase(xylan degradation)
Deposited on 1994-04-01, released 1994-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 1994-10-15, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: xylanase
  Species: Bacillus circulans
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09850 (0-184)
    • conflict (171)
  Domains in SCOP 1.73: d1bcxa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bcxA (A:)
  astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
  ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
  drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmatcgyqssgss
  nvtvw