PDB entry 1bcx

View 1bcx on RCSB PDB site
Description: mutational and crystallographic analyses of the active site residues of the bacillus circulans xylanase
Deposited on 1994-04-01, released 1994-10-15
The last revision prior to the SCOP 1.65 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1bcx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcx_ (-)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmatcgyqssgss
    nvtvw