PDB entry 1bct

View 1bct on RCSB PDB site
Description: three-dimensional structure of proteolytic fragment 163-231 of bacterioopsin determined from nuclear magnetic resonance data in solution
Class: photoreceptor
Keywords: photoreceptor
Deposited on 1993-07-07, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bcta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bctA (A:)
    mrpevastfkvlrnvtvvlwsaypvvwligsegagivplnietllfmvldvsakvgfgli
    llrsraifg