PDB entry 1bcj

View 1bcj on RCSB PDB site
Description: mannose-binding protein-a mutant (qpdwghv) complexed with n-acetyl-d-galactosamine
Class: lectin
Keywords: lectin, c-type lectin, calcium-binding protein
Deposited on 1998-04-30, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: mannose-binding protein-a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19999 (0-153)
      • engineered (81)
      • engineered (112)
      • engineered (114)
      • engineered (116-118)
      • insertion (119-123)
      • engineered (129)
    Domains in SCOPe 2.07: d1bcj11, d1bcj12
  • Chain '2':
    Compound: mannose-binding protein-a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19999 (0-153)
      • engineered (81)
      • engineered (112)
      • engineered (114)
      • engineered (116-118)
      • insertion (119-123)
      • engineered (129)
    Domains in SCOPe 2.07: d1bcj21, d1bcj22
  • Chain '3':
    Compound: mannose-binding protein-a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19999 (0-153)
      • engineered (81)
      • engineered (112)
      • engineered (114)
      • engineered (116-118)
      • insertion (119-123)
      • engineered (129)
    Domains in SCOPe 2.07: d1bcj31, d1bcj32
  • Heterogens: NGA, CA, CL, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcj1 (1:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktvaflgitdevtegqfmyvtggrltysnwkkdqpddwygh
    glgggedcvhivdnglwndiscqashtavcefpa
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcj2 (2:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktvaflgitdevtegqfmyvtggrltysnwkkdqpddwygh
    glgggedcvhivdnglwndiscqashtavcefpa
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcj3 (3:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktvaflgitdevtegqfmyvtggrltysnwkkdqpddwygh
    glgggedcvhivdnglwndiscqashtavcefpa