PDB entry 1bci

View 1bci on RCSB PDB site
Description: c2 domain of cytosolic phospholipase a2, nmr, minimized average structure
Deposited on 1998-04-30, released 1998-11-25
The last revision prior to the SCOP 1.59 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1bci__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bci_ (-)
  yshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwnetf
  efildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvlems
  lev