PDB entry 1bci

View 1bci on RCSB PDB site
Description: c2 domain of cytosolic phospholipase a2, nmr, minimized average structure
Class: hydrolase
Keywords: hydrolase, lipid degradation, cytosolic phospholipase a2, calcium-dependent lipid binding, c2 domain, phosphocholine
Deposited on 1998-04-30, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosolic phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bcia_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bciA (A:)
    msfidpyqhiivehqyshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrt
    rhfnndinpvwnetfefildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkev
    pfifnqvtemvlemslev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bciA (A:)
    yshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwnetf
    efildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvlems
    lev