PDB entry 1bch

View 1bch on RCSB PDB site
Description: mannose-binding protein-a mutant (qpdwgh) complexed with n-acetyl-d-galactosamine
Class: lectin
Keywords: lectin, c-type lectin, calcium-binding protein
Deposited on 1998-04-30, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: mannose-binding protein-a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19999 (0-153)
      • engineered (112)
      • engineered (114)
      • engineered (116-118)
      • insertion (119-123)
      • engineered (129)
    Domains in SCOPe 2.07: d1bch11, d1bch12
  • Chain '2':
    Compound: mannose-binding protein-a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19999 (0-153)
      • engineered (112)
      • engineered (114)
      • engineered (116-118)
      • insertion (119-123)
      • engineered (129)
    Domains in SCOPe 2.07: d1bch21, d1bch22
  • Chain '3':
    Compound: mannose-binding protein-a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19999 (0-153)
      • engineered (112)
      • engineered (114)
      • engineered (116-118)
      • insertion (119-123)
      • engineered (129)
    Domains in SCOPe 2.07: d1bch31, d1bch32
  • Heterogens: A2G, NGA, CA, CL, NA, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bch1 (1:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdqpddwygh
    glgggedcvhivdnglwndiscqashtavcefpa
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bch2 (2:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdqpddwygh
    glgggedcvhivdnglwndiscqashtavcefpa
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bch3 (3:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdqpddwygh
    glgggedcvhivdnglwndiscqashtavcefpa