PDB entry 1bcg

View 1bcg on RCSB PDB site
Description: scorpion toxin bjxtr-it
Class: excitatory neurotoxin
Keywords: excitatory neurotoxin
Deposited on 1998-04-29, released 1998-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxin bjxtr-it
    Species: Hottentotta judaicus [TaxId:6863]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bcga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1bcgA (A:)
mkkngypldrngkttecsgvnaiaphycnsectkvyyaesgyccwgacycfgleddkpig
pmkditkkycdvqiips

    Sequence, based on observed residues (ATOM records): (download) 
    >1bcgA (A:)
mkkngypldrngkttecsgvnaiaphycnsectkvyyaesgyccwgacycfgleddkpig
pmkditkkycdvqi